4taraftarium24 / Taraftarium24

Robots.txt Information

Robot	Path	Permission
GoogleBot	/	✔
BingBot	/	✔
BaiduSpider	/	✔
YandexBot	/	✔

Meta Tags

Title	Taraftarium24 - Canlı Maç İzle
Description	Taraftarium24 yılların verdiği tecrübeyle bütün liglerin maçlarını canlı olarak izlemeniz için hizmet vermektedir. Canlı ve donmadan maçları izleyin.
Keywords	Taraftarium24, taraftarium24, canlı maç izle, bedava maç izle, taraftarium 24, taraftarium, donmayan maç sitesi, donmadan maç izle

Server Information

WebSite	www.4taraftarium24.com
Host IP	104.28.13.201
Location	United States

Related Websites

                    Site
                    Rank
                

More to Explore

ausablevalleygrangefarmersmarkets.com

cooltech.in

themushroomcloud.co.nz

muppadaitrainingacademy.com

4taraftarium24.com Valuation

US$3,756

Last updated: Feb 16, 2020

4taraftarium24.com has global traffic rank of 13,412,187. 4taraftarium24.com has an estimated worth of US$ 3,756, based on its estimated Ads revenue. 4taraftarium24.com receives approximately 228 unique visitors each day. Its web server is located in United States, with IP address 104.28.13.201. According to SiteAdvisor, 4taraftarium24.com is safe to visit.

Traffic & Worth Estimates

Purchase/Sale Value	US$3,756
Daily Ads Revenue	US$2
Monthly Ads Revenue	US$61
Yearly Ads Revenue	US$751
Daily Unique Visitors	228
Note: All traffic and earnings values are estimates.

Traffic Ranks

Global Rank	13,412,187
Delta (90 Days)	0
Most Popular In Country	N/A
Country Rank	N/A

DNS Records

Host	Type	TTL	Data
4taraftarium24.com	A	299	IP: 104.28.12.201
4taraftarium24.com	A	299	IP: 104.28.13.201
4taraftarium24.com	AAAA	299	IPv6: 2606:4700:3036:0:0:0:681c:cc9
4taraftarium24.com	AAAA	299	IPv6: 2606:4700:3035:0:0:0:681c:dc9
4taraftarium24.com	NS	21599	Target: eva.ns.cloudflare.com.
4taraftarium24.com	NS	21599	Target: dan.ns.cloudflare.com.
4taraftarium24.com	SOA	3599	MNAME: dan.ns.cloudflare.com. RNAME: dns.cloudflare.com. Serial: 2033252042 Refresh: 10000 Retry: 2400 Expire: 604800 Minimum TTL: 3600

HTTP Headers

HTTP/1.1 301 Moved Permanently
Date: Sun, 16 Feb 2020 01:48:54 GMT
Content-Type: text/html; charset=iso-8859-1
Transfer-Encoding: chunked
Connection: keep-alive
Set-Cookie: __cfduid=d7afade22483dba63a842749886c36b301581817734; expires=Tue, 17-Mar-20 01:48:54 GMT; path=/; domain=.4taraftarium24.com; HttpOnly; SameSite=Lax
Location: http://ww6.canadianapharcharmyonline.com/
CF-Cache-Status: DYNAMIC
Server: cloudflare
CF-RAY: 565bdca7dceec5c4-EWR

HTTP/1.1 200 OK
Date: Sun, 16 Feb 2020 01:48:54 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Set-Cookie: __cfduid=d175b3739589a2036da37f7c832eb8d401581817734; expires=Tue, 17-Mar-20 01:48:54 GMT; path=/; domain=.canadianapharcharmyonline.com; HttpOnly; SameSite=Lax
Vary: Accept-Encoding
Last-Modified: Thu, 13 Feb 2020 14:33:23 GMT
CF-Cache-Status: DYNAMIC
Server: cloudflare
CF-RAY: 565bdca90e8dc5c4-EWR

4taraftarium24.com Whois Information

   Domain Name: 4TARAFTARIUM24.COM
   Registry Domain ID: 2239305145_DOMAIN_COM-VRSN
   Registrar WHOIS Server: whois.name.com
   Registrar URL: http://www.name.com
   Updated Date: 2019-03-16T07:26:32Z
   Creation Date: 2018-03-15T13:49:02Z
   Registry Expiry Date: 2020-03-15T13:49:02Z
   Registrar: Name.com, Inc.
   Registrar IANA ID: 625
   Registrar Abuse Contact Email: abuse@name.com
   Registrar Abuse Contact Phone: 7202492374
   Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
   Name Server: DAN.NS.CLOUDFLARE.COM
   Name Server: EVA.NS.CLOUDFLARE.COM
   DNSSEC: unsigned
   URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/

Domain Name: 4TARAFTARIUM24.COM 
Registry Domain ID: 2239305145_DOMAIN_COM-VRSN 
Registrar WHOIS Server: whois.name.com 
Registrar URL: http://www.name.com 
Updated Date: 2019-03-16T07:26:32Z 
Creation Date: 2018-03-15T13:49:02Z 
Registrar Registration Expiration Date: 2020-03-15T13:49:02Z 
Registrar: Name.com, Inc. 
Registrar IANA ID: 625 
Reseller:  
Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited 
Registry Registrant ID: Not Available From Registry 
Registrant Name: Whois Agent 
Registrant Organization: Domain Protection Services, Inc. 
Registrant Street: PO Box 1769  
Registrant City: Denver 
Registrant State/Province: CO 
Registrant Postal Code: 80201 
Registrant Country: US 
Registrant Phone: +1.7208009072 
Registrant Fax: +1.7209758725 
Registrant Email: https://www.name.com/contact-domain-whois/4taraftarium24.com 
Registry Admin ID: Not Available From Registry 
Admin Name: Whois Agent 
Admin Organization: Domain Protection Services, Inc. 
Admin Street: PO Box 1769  
Admin City: Denver 
Admin State/Province: CO 
Admin Postal Code: 80201 
Admin Country: US 
Admin Phone: +1.7208009072 
Admin Fax: +1.7209758725 
Admin Email: https://www.name.com/contact-domain-whois/4taraftarium24.com 
Registry Tech ID: Not Available From Registry 
Tech Name: Whois Agent 
Tech Organization: Domain Protection Services, Inc. 
Tech Street: PO Box 1769  
Tech City: Denver 
Tech State/Province: CO 
Tech Postal Code: 80201 
Tech Country: US 
Tech Phone: +1.7208009072 
Tech Fax: +1.7209758725 
Tech Email: https://www.name.com/contact-domain-whois/4taraftarium24.com 
Name Server: dan.ns.cloudflare.com 
Name Server: eva.ns.cloudflare.com 
DNSSEC: unSigned 
Registrar Abuse Contact Email: abuse@name.com 
Registrar Abuse Contact Phone: +1.7203101849 
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/

4taraftarium24.com valuation and analysis